PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627768.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 998aa    MW: 110885 Da    PI: 4.9292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627768.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-173680348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_009627768.1 36 QWTPEEDEILRQAVQLFKGKSWKRIAECFK-DRTDVQCLHRWQKVL 80
                     7****************************9.************986 PP

2Myb_DNA-binding59.95.4e-1986132148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+++v+++G++ W+tIa+++  gR +kqc++rw+++l
   XP_009627768.1  86 KGSWTKEEDDKLIELVNRYGPKKWSTIAQELA-GRIGKQCRERWHNHL 132
                      799*****************************.*************97 PP

3Myb_DNA-binding45.81.4e-14138180145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+  a+ +  gR+++ +k++w+
   XP_009627768.1 138 KEPWTQEEELTLIRAHQVYGNK-WAELAKVLH-GRSDNAIKNHWH 180
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.74E-152986IPR009057Homeodomain-like
PROSITE profilePS5129418.5182980IPR017930Myb domain
SMARTSM007175.5E-143382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-193689IPR009057Homeodomain-like
PfamPF002493.3E-153680IPR001005SANT/Myb domain
CDDcd001671.93E-133780No hitNo description
PROSITE profilePS5129431.82181136IPR017930Myb domain
SuperFamilySSF466891.57E-3083179IPR009057Homeodomain-like
SMARTSM007172.3E-1885134IPR001005SANT/Myb domain
CDDcd001673.06E-1688132No hitNo description
PfamPF139211.1E-1989147No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2690139IPR009057Homeodomain-like
SMARTSM007173.1E-14137185IPR001005SANT/Myb domain
PROSITE profilePS5129419.233137187IPR017930Myb domain
CDDcd001671.02E-10140180No hitNo description
Gene3DG3DSA:1.10.10.601.1E-21140187IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 998 aa     Download sequence    Send to blast
MESDKTSTTP SDDISSLQRV QPLNGRTSGP KRRSSQWTPE EDEILRQAVQ LFKGKSWKRI  60
AECFKDRTDV QCLHRWQKVL DPELVKGSWT KEEDDKLIEL VNRYGPKKWS TIAQELAGRI  120
GKQCRERWHN HLNPSINKEP WTQEEELTLI RAHQVYGNKW AELAKVLHGR SDNAIKNHWH  180
SSVKKKLDSY LASGLLAQFP ALPNVNHQNQ SVPSSSMTLQ QNSEDESVHK QGTEAEDSFV  240
KKKLDSYLAS GLLGQFPALP NVNHQNQSVP SSSMTLQQNS EDESVHKEGT EAEEVPECSQ  300
GSTFAGCSQS TSDLGNTFVH VRENGGMSEE SICKKDATSS TAPCCRNYNP VFQDVSCSML  360
KVPSELVDSK FLEHNLSHDG GNSMEEDWQF NRDDIPNISP PELIQESSGI SVHCLNGNEN  420
HDMEATTNVG NVVEGPYNPN EMFVCVDSCM MVYPEEGIPQ CSSETGVNGC GQPAYSLFYR  480
SSNYQIPEVG DMVPQNCNAL SFDDFEASSH QPFSVPLQFS SEDRSPVFDL VLNQFHNPPL  540
ESPDHMKDSS RIVPVNDLGS TTSNTVQTCL LNEKSFVQEK QKDGGGLCYD PPRFPSSDVP  600
FFCCDLMQSG SDTQEEYSPF GIRQLMMTSA NCLTPLRLWD SPSRDDSPDA ILKSAAKTFT  660
GTPSILKKRH RHLLSPLSEK RCEKRLESDL NQESFSNMTS NFSRLDDMFD ESANEKASME  720
DGENLPSSED GRKEEGEISG ANDAMGKVKQ PPGVLVELSS NDLFLSPDSF LIKCDRATSL  780
SNKALGKQYA RRLEAASNQV TVSSSFETSC FSVVCSPDIR GKRRSSVVLA TSAALGNTAE  840
DSENRFGTET LSISGETPYK RSFESPSAWK SPWFMNSFPP STRYDTELAF EDLARFMSPG  900
DRSYDAIGLM KQLSEQTAAS IADAHQILGS ETPETNLSKR NSKKQKADEI CKASNATSER  960
RTLDFNECGT PGKGKETTKF GSNNSFSSPS SYLLKYCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-63301877159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-63301877159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0561220.0AB056122.1 Nicotiana tabacum NtmybA1 mRNA for Myb, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627768.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_009627769.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_009627770.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLQ948S60.0Q948S6_TOBAC; Myb
STRINGPGSC0003DMT4000478250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-100Homeodomain-like protein